Art of Problem Solving
AoPS Online
Math texts, online classes, and more
for students in grades 5-12.
Visit AoPS Online ‚
Books for Grades 5-12 Online Courses
Beast Academy
Engaging math books and online learning
for students ages 6-13.
Visit Beast Academy ‚
Books for Ages 6-13 Beast Academy Online
AoPS Academy
Small live classes for advanced math
and language arts learners in grades 2-12.
Visit AoPS Academy ‚
Find a Physical Campus Visit the Virtual Campus

Orphaned pages

The following pages are not linked from or transcluded into other pages in AoPS Wiki.

Showing below up to 250 results in range #251 to #500.

View (previous 250 | next 250) (20 | 50 | 100 | 250 | 500)

  1. Chakravala method
  2. Challenge Math Online Program
  3. Changelog
  4. Channing421
  5. Charfoal
  6. Chen's Theorem
  7. Chittur Gopalakrishnavishwanathasrinivasaiyer Lemma
  8. Circle Theorems
  9. Class Badges
  10. Classroom hacks
  11. Cloud neek
  12. Coalition Under Lovers of Trees
  13. Cohn's criterion
  14. Collections
  15. Complete residue system
  16. Computer simulation
  17. Concave Function
  18. Conservation of Momentum
  19. Constraints Strategy
  20. Contest Statistics
  21. Cool972 AMC 8 I
  22. Cozzmo
  23. Creating edited defaults
  24. Critical point
  25. Crouton
  26. Crusade
  27. Cumsniffer
  28. Curisen
  29. Curvature
  30. Cyclic function
  31. DVI exam
  32. Decagon
  33. Decembersnow13
  34. Decibel
  35. Descent
  36. Did you know that 3-2=1?
  37. Digon
  38. Dihedral angle
  39. Direacted lenght
  40. Direct Image Link
  41. Discordbetterthanaops
  42. Discrete quantity
  43. Dissection
  44. Distinct lines
  45. Doctorwho11
  46. Doggo
  47. Dolphinday
  48. Donguri
  49. Douglasubella
  50. Dunan's Theorem
  51. Dunan League
  52. Duwipr
  53. Earth
  54. Earth Science
  55. Easter Eggs
  56. Editing 2010 AMC 8 PROBLEMS/PROBLEM 24
  57. Ehawk11
  58. Emojis
  59. Erich Owen
  60. ErickMeyer4
  61. Euclid Problems and Solutions
  62. Euclid history Problems
  63. Euler's Four-Square Identity
  64. Euler's formula and It's history
  65. Euler's theorem
  66. European Girls' Mathematical Olympiad
  67. Exponentiation by squaring
  68. Exradius
  69. F=ma Exam
  70. FBIA
  71. FMO Problems and Solutions
  72. Fat Man on a Seesaw
  73. Fermat's Two Squares Theorem
  74. Fermat numbers
  75. Feuerbach point
  76. Finite Fourier Analysis
  77. Firecobra100
  78. First hundred primes
  79. Fixer
  80. Flec
  81. Fluorescence
  82. Foot Prints Of God
  83. Footballjornalista/
  84. For what real values of $c$ is $4x^2 + 5x^2 + 14x + x + c$ the square of a binomial?
  85. Forms of Figurative Language
  86. Formulas relating the number of lines, sections, and intersection points
  87. Forum Etiquette
  88. Forums
  89. Four
  90. Four fair coins are to be flipped. What is the probability that all four will be heads or all four will be tails? Express your answer as a common fraction.
  91. François Viète
  92. Invalid title with namespace "(Main)" and text "François_Viète"
  93. Free magma
  94. Frobenius automorphism
  95. Fucongcong
  96. Full of Baloney
  97. Fun Math Puzzles Unofficial
  98. GIFs
  99. GMAAS
  100. Gaamster
  101. Game Programming Contest
  102. Garmin launches a new FDA-cleared ECG app for the Venu 2 Plus
  103. Gauss's Lemma
  104. Gauss (Gr. 7 & 8)
  105. Gauss Grade 7 Year 2011 Problem 1
  106. Gauss Grade 7 Year 2011 Problem 2
  107. Gauss Grade 7 Year 2011 Problem 4
  108. Geometry Solutions
  109. Georgeooga-Harryooga Theroem
  110. Gergonne's Theorem
  111. Getting Started With JavaScript Programming
  112. Gg boiiis
  113. Ghsfaodsjfsdf theorum
  114. GloriaVaughn2
  115. Gmaasalaxy
  116. Gmaasiverse
  117. Gods Fighting Sim
  118. Graphgrid.asy
  119. Grog
  120. Halp!
  121. Happyshark's User Page
  122. Harry Kim
  123. Harvey
  124. Heavytoothpaste
  125. Helios Hong
  126. Hendecagon
  127. Heptadecagon
  128. Hexadecagon
  129. High-Quality Games and Fun
  130. Honest day's work
  131. Hook Length Theorem
  132. Horsepower
  133. Hotmonkey's current phrase
  134. How many four-digit, positive integers are there where each digit is a prime number?
  135. How many prime numbers are between 30 and 40?
  136. How many times does the digit 9 appear in the list of all integers from 1 to 500? (The number $ 99 $, for example, is counted twice, because $9$ appears two times in it.)
  137. How many ways can $1995$ be factored as a product of two two-digit numbers? (Two factorizations of the form $a\cdot b$ and $b\cdot a$ are considered the same).
  138. How should I prepare?
  139. How to Add and Subtract One-Digit Numbers
  140. How to Learn Turkish Language Fast
  141. How to display images or GIFs
  142. How to set up your new computer the right way
  143. HowtoHangStringLights
  144. Https://artofproblemsolving.com/wiki/index.php?title=File:AMC logo.png
  145. Huili2010
  146. Hyperbolic trig functions
  147. Hyundai Ioniq 5
  148. IDEAMATH
  149. Iabzcq
  150. Ice neek
  151. Icosagon
  152. Icosidigon
  153. Icosihenagon
  154. Idempotence
  155. Idkhtan Theorem
  156. If I have four boxes arranged in a $2 \times 2$ grid, in how many distinct ways can I place the digits $1$, $2$, and $3$ in the boxes, using each digit exactly once, such that each box contains at most one digit? (I only have one of each digit, so one box
  157. If no one shares an office, in how many ways can 3 people be assigned to 5 different offices? (Each person gets exactly one office).
  158. In the diagram, the equilateral triangle has a base of $8$ m. What is the perimeter of the triangle?
  159. In triangle ABC, D be a point in BC, ∠BAD = 30 , ∠CAD = 90 , BD=1=AC, DC =
  160. Index.php
  161. Indianvv
  162. Infinite Defenestration
  163. Inscribed Angle Proof(1)
  164. Insiders bet more on Fizz a social network that has now bubbled up at 80 college campuses
  165. Integrals
  166. IntelligentElephant2010
  167. Intermediate value property
  168. Internal combustion engines
  169. International Math Bowl
  170. Inverse trigonometric function
  171. Involution
  172. It1023
  173. JDKim
  174. JMPSC 2022 Division 1 Round 2 Problem 14
  175. JMPSC 2022 Problems
  176. Jadhav Quadratic Formula
  177. Jamesgray
  178. Jason321
  179. Jason Batterson
  180. Javascript
  181. Jayasharmaramankumarguptareddybavarajugopal's Lemma
  182. Jeff Boyd
  183. Joe wants to find all the four-letter words that begin and end with the same letter. How many combinations of letters satisfy this property?
  184. Jomity
  185. Joshua zucker
  186. Jugemu Jugemu Goko no Surikire Kaijarisuigyo no Suigyomatsu Unraimatsu Furaimatsu Ku Neru Tokoro ni Sumu Tokoro Yabura Koji no Bura Koji Paipo-paipo Paipo no ShuringanShuringan no Gurindai Gurindai no Ponpokopi no Ponpokona no Chokyumei no Chosuke.
  187. Juliankuang
  188. Jupiter314
  189. K1glaucus
  190. KGS math club
  191. Kenzopoker
  192. Kevin Zhao
  193. Kirchhoff's rules
  194. KiwiYum
  195. Kiwibird52
  196. Know the Facts: Gmaas
  197. Kuytltuyluyc
  198. Invalid title with namespace "(Main)" and text "L'Hôpital's_Rule"
  199. LaTeX/Installing
  200. Laa: Packages
  201. Lagrange Multipliers
  202. Latin square
  203. Laurent Series
  204. Lcz's Mock AMC 10A
  205. Lcz's Mock AMC 10A Problems
  206. Lcz's Oly Notes
  207. Lcz Notes!
  208. Learning Physics!
  209. Let $x$ be the number $9$ followed by $2015$ zeros. What is smallest integer greater than or equal to $x$ that is divisible by 11? Expression your answer in terms of $x$.
  210. Let a and b be nonzero real numbers such that (2 - 7i)(a + bi)is pure imaginary. Find a/b.
  211. Lifting the Exponent Lemma
  212. Lillian
  213. Liouville's Theorem
  214. List of national MathCounts teams
  215. Look at their Health Needs
  216. Lorde Shares Sweet Texts From Taylor Swift
  217. Lorentz Factor
  218. LostInBali
  219. LouisMedina23
  220. Lucasfunnyface
  221. Luckypotatopoo
  222. Luke zhang
  223. LuzPowell2
  224. MIE 2016/Day 1/Problem 10
  225. MIE 2016/Day 1/Problem 6
  226. MIE 2016/Day 1/Problem 7
  227. MIE 2016/Day 1/Problem 8
  228. MIE 2016/Problem 2
  229. MIE 2016/Problem 9
  230. MMFC
  231. MNCTOTO
  232. MSHSML Problems and Solutions
  233. MaCh 8
  234. Maggie
  235. Magic Problem
  236. Magic squares
  237. Main Page/Suggestions
  238. Main page
  239. Making AI with Python
  240. Manchestermag.com
  241. Marin Mersenne
  242. Mark888's Hangout Corner
  243. Massass
  244. Math2016Center
  245. MathCON
  246. MathCounts: National Cutoffs
  247. MathLegend27
  248. Math Contest Camp 2008
  249. Math Contest Camp 2009
  250. Math Contest Camp 2010

View (previous 250 | next 250) (20 | 50 | 100 | 250 | 500)

Retrieved from "https://artofproblemsolving.com/wiki/index.php/Special:LonelyPages"