Art of Problem Solving
AoPS Online
Math texts, online classes, and more
for students in grades 5-12.
Visit AoPS Online ‚
Books for Grades 5-12 Online Courses
Beast Academy
Engaging math books and online learning
for students ages 6-13.
Visit Beast Academy ‚
Books for Ages 6-13 Beast Academy Online
AoPS Academy
Small live classes for advanced math
and language arts learners in grades 2-12.
Visit AoPS Academy ‚
Find a Physical Campus Visit the Virtual Campus

Orphaned pages

The following pages are not linked from or transcluded into other pages in AoPS Wiki.

Showing below up to 500 results in range #1 to #500.

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

  1. "* in a unit circle"
  2. ++ ดูหนังมาใหม่ ธี่หยด (2023) Tee Yod หนังชนโรง หนังออนไลน์ฟรี
  3. 14639201037200387267
  4. 19329 contest math: intro to geometry
  5. 1939 AMC 8 Problems
  6. 1959–1966 IMO Longlist Problems/Czechoslovakia 1
  7. 1967 AHSME Problems/Problem 49
  8. 1967 AHSME Problems/Problem 50
  9. 1970 AMC 12
  10. 1983 AIME/Answer Key
  11. 1983 USAMO Problem 1
  12. 1984 AJHSME Problem 9
  13. 1985 AJHSME Problems/Problem 0
  14. 1991 OIM Problems/Problem 7
  15. 20
  16. 2000˙AIME˙II˙Problems/Problem˙3
  17. 2001 AMC 12 Printable
  18. 2002 AMC 10P Problems/Problem 15
  19. 2002 SMT
  20. 2003 SMT
  21. 2004 AMC 10A Answers
  22. 2004 SMT
  23. 2005 AIME
  24. 2005 CEMC Gauss (Grade 7) Problems/Problem 2a
  25. 2005 SMT
  26. 2006 AIME
  27. 2006 GCTM State Tournament Problems/Individual Problem 46
  28. 2007 AIME
  29. 2007 AIME Root(2)
  30. 2007 SMT
  31. 2007 USA TST Problems
  32. 2008 AIME
  33. 2008 AMC 12 A
  34. 2008 Polish Mathematical Olympiad Third Round
  35. 2008 SMT
  36. 2008 UNC Math Contest II Problems/Problem 1
  37. 2009 MMATHS Individual Round Problems/Problem 1
  38. 2009 PUMaC Problems
  39. 2009 Polish Mathematical Olympiad Third Round
  40. 2009 SMT
  41. 2009 Zhautykov International Olympiad Problems
  42. 2010-2011 Mock USAJMO 2 Problems/Solutions
  43. 2010 AMC 12A Problems Raw
  44. 2010 SMT
  45. 2012 EGMO
  46. 2013 EGMO Problems
  47. 2013 TSTST Problems
  48. 2014 EGMO Problems
  49. 2014 UNC) Math Contest II Problems
  50. 2014 UNM-PNM Math Contest II Problems/Problem 2
  51. 2015 EGMO Problems
  52. 2015 Final tour - Azerbaijan in lower age category
  53. 2016 AMC 10 Problems
  54. 2016 EGMO Problems
  55. 2016 Mathcounts State Sprint Problems
  56. 2017 AMC 10B Problems/Problem 12/section=4
  57. 2017 EGMO Problems
  58. 2018 AMC 12 Problems/Problem 16
  59. 2018 EGMO Problems
  60. 2018 TSTST Problems
  61. 2019 AIME Problems
  62. 2019 AIME Problems/Problem 2
  63. 2019 AMC 10
  64. 2019 EGMO Problems
  65. 2019 ELMO Problems
  66. 2019 USAJMO Problems/Problem 10
  67. 2019 USAJMO Problems/Problem 69
  68. 2020 AMC 8 Problems/em 1
  69. 2020 EGMO Problems
  70. 2020 FMC 10A Problems
  71. 2020 FMC 12A Problems
  72. 2020 MATHCOUNTS Problems/Problem 8
  73. 2020 Mock Combo AMC 10
  74. 2020 USAMTS Round 1 Problems/Problem 3
  75. 2020 USAMTS Round 1 Problems/Problem 4
  76. 2020 USAMTS Round 1 Problems/Problem 5
  77. 2021 AMC 10B Problems/Problem 26
  78. 2021 AMC 10C
  79. 2021 AMC 10D
  80. 2021 AMC 1 Problems
  81. 2021 AMC 8 Problems
  82. 2021 AMC 8 Problems/Problem 1
  83. 2021 AMC 8 Problems/Problem 18
  84. 2021 AMC 8 Problems/Problem 2
  85. 2021 April MIMC 10
  86. 2021 April MIMC Problems/Problem 18
  87. 2021 April MIMC Problems/Problem 19
  88. 2021 EGMO Problems
  89. 2021 Euclid Problems
  90. 2021 Fall MIMC 10
  91. 2021 GMC 10B
  92. 2021 GMC 12
  93. 2021 GMC 12B
  94. 2021 HMC 10
  95. 2021 JMC 10
  96. 2021 JMPSC
  97. 2021 JMPSC Answer Key
  98. 2021 JMPSC Problems/Problem 1
  99. 2021 JMPSC Problems/Problem 2
  100. 2021 MECC Mock AMC 10
  101. 2021 MECC Mock AMC 12
  102. 2021 Mock AMC 8 Problems
  103. 2021 Mock AMC 8 Problems/Problem 1
  104. 2021 Mock AMC 8 Problems/Problem 2
  105. 2021 Mock AMC 8 Problems/Problem 3
  106. 2021 WSMO
  107. 2021 WSMO Speed Round/Problem 1
  108. 2021 ZeMC10
  109. 2022 DMC 10A Problems
  110. 2022 EGMO Problems
  111. 2022 Fall AMC 10B Problems
  112. 2022 MMATHS
  113. 2022 MMATHS Individual Round
  114. 2022 MMATHS Individual Round Problems
  115. 2022 MMATHS Problems/Problem 1
  116. 2023 AMC 10A Problems/Problem 26
  117. 2023 AMC 10A Problems/Problem 27
  118. 2023 AMC 10B Problems/Problem 26
  119. 2024 AMC 10B
  120. 2024 AMC 8 Problems/Problem 26
  121. 2024 AMC 8 Problems/Problem 27
  122. 2024 UAJMO Problems
  123. 2025 AMC 10A
  124. 2026 AMC 8 Problems
  125. 2027 AMC 8 Problems/Problem 1
  126. 2028 AMC 8
  127. 2030 AIME I
  128. 2050 AIME I
  129. 2100 AMC 8 Problems
  130. 403
  131. 404
  132. 7
  133. A
  134. A-Star Winter Math Camp
  135. A.chepuri
  136. AAMC
  137. AMC 10P
  138. AMC 12C 2019
  139. AMC 12C 2019/Problem 1
  140. AMC 12C 2020
  141. AMC 4
  142. AMC 8 Scheiße Scheisse and Solutions
  143. AMC 8 practice test
  144. AOPS
  145. API::Order::generate
  146. API:Product:get weight
  147. API Main Page
  148. AP Calculus
  149. A choose b
  150. A game board is constructed by shading two of the regions formed by the altitudes of an equilateral triangle as shown. What is the probability that the tip of the spinner will come to rest in a shaded region? Express your answer as a common fraction.
  151. A stock loses $10\%$ of its value on Monday. On Tuesday it loses $20\%$ of the value it had at the end of the day on Monday. What is the overall percent loss in value from the beginning of Monday to the end of Tuesday? Enter the answer as a percent.
  152. About weihang
  153. Aceplays
  154. Action
  155. Adazhao1227
  156. Add
  157. Additional signaling system at work
  158. Adriancheung
  159. Advanced Gmaasology
  160. Advanced Placement
  161. Ajax
  162. Alcumus
  163. Alex
  164. Algebra 2023
  165. Ali-A
  166. Alicebarnes33
  167. Alkjl
  168. All about Magic
  169. Alt front page
  170. Alternating permutation
  171. American Math Challenge
  172. Angle Addition Formulas (Trigonometry)
  173. Annual Inequations Contest
  174. Anthony Yang
  175. AoPSML Main Page
  176. AoPSWiki:Article of the Day/Archive
  177. AoPSWiki:Community Portal
  178. AoPS Math Club
  179. AoPS Online School/Algebra 2
  180. AoPS Online Schoolhouse
  181. Aops Guide to Math!
  182. Aops language
  183. Aopsav
  184. Aopslandia
  185. Apple
  186. Applicant Tracking Systems
  187. Arclength
  188. Areteem Camp
  189. Areteem Institute Summer Math Programs
  190. Arienhost.com
  191. Arrangement Restriction Theorem
  192. Arthur Benjamin
  193. Arthur Holly Compton Fellowships in the Physical Sciences and Mathematics
  194. Asymptote: Crash Course
  195. Asymptote: Example 1
  196. Asymptote: Macintosh
  197. Autograph
  198. Avid Academy for Gifted Youth
  199. Avogadro's Constant
  200. Awesomeguy856
  201. Awesomeming327
  202. Ayy-opsss
  203. B
  204. B2025tyx
  205. Badges
  206. Bard Math Circle Creative and Analytical Math Program (C.A.M.P.)
  207. Barrington High School
  208. Base arithmetic
  209. Base introduction
  210. Bash
  211. Bay Area Math Olympiad
  212. Beckyspencer3
  213. Benhlyrangcom
  214. Besot Power Series
  215. BestieTheorem
  216. Bestzack66's AMC10 Study Plan
  217. Bibhorr Formula
  218. Bill's Triangle
  219. Binomial Nomenclature
  220. Biswadev
  221. Bjc
  222. Blank Page
  223. BlockFi
  224. Bob Smart
  225. BoddapatiS
  226. Boredom Buster
  227. Brachistochrone
  228. Brazilformula
  229. Brocard's problem
  230. Brute for
  231. Bézout's Lemma
  232. CMO
  233. CSS: Downloads
  234. CSS: Positioning
  235. CSS: Properties
  236. CSS and HTML fundamentals
  237. Calculators
  238. Caltech
  239. Caltech Math Meet
  240. Camp-euclid
  241. Casey's Theoram
  242. Catch 22
  243. Catenary
  244. Cauchy's Criterion
  245. Cauchy-davenport
  246. Cavalieri's principle
  247. Cayley's Theorem
  248. Cell Theory
  249. Central NC MathCounts
  250. Centslordm
  251. Chakravala method
  252. Changelog
  253. Channing421
  254. Charfoal
  255. Chen's Theorem
  256. Chittur Gopalakrishnavishwanathasrinivasaiyer Lemma
  257. Circle Theorems
  258. Class Badges
  259. Classroom hacks
  260. Cloud neek
  261. Coalition Under Lovers of Trees
  262. Cohn's criterion
  263. Collections
  264. Complete residue system
  265. Computer simulation
  266. Concave Function
  267. Conservation of Momentum
  268. Constraints Strategy
  269. Contest Statistics
  270. Cool972 AMC 8 I
  271. Cozzmo
  272. Creating edited defaults
  273. Critical point
  274. Crouton
  275. Crusade
  276. Cumsniffer
  277. Curisen
  278. Curvature
  279. Cyclic function
  280. DVI exam
  281. Decagon
  282. Decembersnow13
  283. Decibel
  284. Descent
  285. Did you know that 3-2=1?
  286. Digon
  287. Dihedral angle
  288. Direacted lenght
  289. Direct Image Link
  290. Discordbetterthanaops
  291. Discrete quantity
  292. Dissection
  293. Distinct lines
  294. Doctorwho11
  295. Doggo
  296. Dolphinday
  297. Donguri
  298. Douglasubella
  299. Dunan's Theorem
  300. Dunan League
  301. Duwipr
  302. Earth
  303. Earth Science
  304. Easter Eggs
  305. Editing 2010 AMC 8 PROBLEMS/PROBLEM 24
  306. Ehawk11
  307. Emojis
  308. Erich Owen
  309. ErickMeyer4
  310. Euclid Problems and Solutions
  311. Euclid history Problems
  312. Euler's Four-Square Identity
  313. Euler's formula and It's history
  314. Euler's theorem
  315. European Girls' Mathematical Olympiad
  316. Exponentiation by squaring
  317. Exradius
  318. F=ma Exam
  319. FBIA
  320. FMO Problems and Solutions
  321. Fat Man on a Seesaw
  322. Fermat's Two Squares Theorem
  323. Fermat numbers
  324. Feuerbach point
  325. Finite Fourier Analysis
  326. Firecobra100
  327. First hundred primes
  328. Fixer
  329. Flec
  330. Fluorescence
  331. Foot Prints Of God
  332. Footballjornalista/
  333. For what real values of $c$ is $4x^2 + 5x^2 + 14x + x + c$ the square of a binomial?
  334. Forms of Figurative Language
  335. Formulas relating the number of lines, sections, and intersection points
  336. Forum Etiquette
  337. Forums
  338. Four
  339. Four fair coins are to be flipped. What is the probability that all four will be heads or all four will be tails? Express your answer as a common fraction.
  340. François Viète
  341. Invalid title with namespace "(Main)" and text "François_Viète"
  342. Free magma
  343. Frobenius automorphism
  344. Fucongcong
  345. Full of Baloney
  346. Fun Math Puzzles Unofficial
  347. GIFs
  348. GMAAS
  349. Gaamster
  350. Game Programming Contest
  351. Garmin launches a new FDA-cleared ECG app for the Venu 2 Plus
  352. Gauss's Lemma
  353. Gauss (Gr. 7 & 8)
  354. Gauss Grade 7 Year 2011 Problem 1
  355. Gauss Grade 7 Year 2011 Problem 2
  356. Gauss Grade 7 Year 2011 Problem 4
  357. Geometry Solutions
  358. Georgeooga-Harryooga Theroem
  359. Gergonne's Theorem
  360. Getting Started With JavaScript Programming
  361. Gg boiiis
  362. Ghsfaodsjfsdf theorum
  363. GloriaVaughn2
  364. Gmaasalaxy
  365. Gmaasiverse
  366. Gods Fighting Sim
  367. Graphgrid.asy
  368. Grog
  369. Halp!
  370. Happyshark's User Page
  371. Harry Kim
  372. Harvey
  373. Heavytoothpaste
  374. Helios Hong
  375. Hendecagon
  376. Heptadecagon
  377. Hexadecagon
  378. High-Quality Games and Fun
  379. Honest day's work
  380. Hook Length Theorem
  381. Horsepower
  382. Hotmonkey's current phrase
  383. How many four-digit, positive integers are there where each digit is a prime number?
  384. How many prime numbers are between 30 and 40?
  385. How many times does the digit 9 appear in the list of all integers from 1 to 500? (The number $ 99 $, for example, is counted twice, because $9$ appears two times in it.)
  386. How many ways can $1995$ be factored as a product of two two-digit numbers? (Two factorizations of the form $a\cdot b$ and $b\cdot a$ are considered the same).
  387. How should I prepare?
  388. How to Add and Subtract One-Digit Numbers
  389. How to Learn Turkish Language Fast
  390. How to display images or GIFs
  391. How to set up your new computer the right way
  392. HowtoHangStringLights
  393. Https://artofproblemsolving.com/wiki/index.php?title=File:AMC logo.png
  394. Huili2010
  395. Hyperbolic trig functions
  396. Hyundai Ioniq 5
  397. IDEAMATH
  398. Iabzcq
  399. Ice neek
  400. Icosagon
  401. Icosidigon
  402. Icosihenagon
  403. Idempotence
  404. Idkhtan Theorem
  405. If I have four boxes arranged in a $2 \times 2$ grid, in how many distinct ways can I place the digits $1$, $2$, and $3$ in the boxes, using each digit exactly once, such that each box contains at most one digit? (I only have one of each digit, so one box
  406. If no one shares an office, in how many ways can 3 people be assigned to 5 different offices? (Each person gets exactly one office).
  407. In the diagram, the equilateral triangle has a base of $8$ m. What is the perimeter of the triangle?
  408. In triangle ABC, D be a point in BC, ∠BAD = 30 , ∠CAD = 90 , BD=1=AC, DC =
  409. Index.php
  410. Indianvv
  411. Infinite Defenestration
  412. Inscribed Angle Proof(1)
  413. Insiders bet more on Fizz a social network that has now bubbled up at 80 college campuses
  414. Integrals
  415. IntelligentElephant2010
  416. Intermediate value property
  417. Internal combustion engines
  418. International Math Bowl
  419. Inverse trigonometric function
  420. Involution
  421. It1023
  422. JDKim
  423. JMPSC 2022 Division 1 Round 2 Problem 14
  424. JMPSC 2022 Problems
  425. Jadhav Quadratic Formula
  426. Jamesgray
  427. Jason321
  428. Jason Batterson
  429. Javascript
  430. Jayasharmaramankumarguptareddybavarajugopal's Lemma
  431. Jeff Boyd
  432. Joe wants to find all the four-letter words that begin and end with the same letter. How many combinations of letters satisfy this property?
  433. Jomity
  434. Joshua zucker
  435. Jugemu Jugemu Goko no Surikire Kaijarisuigyo no Suigyomatsu Unraimatsu Furaimatsu Ku Neru Tokoro ni Sumu Tokoro Yabura Koji no Bura Koji Paipo-paipo Paipo no ShuringanShuringan no Gurindai Gurindai no Ponpokopi no Ponpokona no Chokyumei no Chosuke.
  436. Juliankuang
  437. Jupiter314
  438. K1glaucus
  439. KGS math club
  440. Kenzopoker
  441. Kevin Zhao
  442. Kirchhoff's rules
  443. KiwiYum
  444. Kiwibird52
  445. Know the Facts: Gmaas
  446. Kuytltuyluyc
  447. Invalid title with namespace "(Main)" and text "L'Hôpital's_Rule"
  448. LaTeX/Installing
  449. Laa: Packages
  450. Lagrange Multipliers
  451. Latin square
  452. Laurent Series
  453. Lcz's Mock AMC 10A
  454. Lcz's Mock AMC 10A Problems
  455. Lcz's Oly Notes
  456. Lcz Notes!
  457. Learning Physics!
  458. Let $x$ be the number $9$ followed by $2015$ zeros. What is smallest integer greater than or equal to $x$ that is divisible by 11? Expression your answer in terms of $x$.
  459. Let a and b be nonzero real numbers such that (2 - 7i)(a + bi)is pure imaginary. Find a/b.
  460. Lifting the Exponent Lemma
  461. Lillian
  462. Liouville's Theorem
  463. List of national MathCounts teams
  464. Look at their Health Needs
  465. Lorde Shares Sweet Texts From Taylor Swift
  466. Lorentz Factor
  467. LostInBali
  468. LouisMedina23
  469. Lucasfunnyface
  470. Luke zhang
  471. LuzPowell2
  472. MIE 2016/Day 1/Problem 10
  473. MIE 2016/Day 1/Problem 6
  474. MIE 2016/Day 1/Problem 7
  475. MIE 2016/Day 1/Problem 8
  476. MIE 2016/Problem 2
  477. MIE 2016/Problem 9
  478. MMFC
  479. MNCTOTO
  480. MSHSML Problems and Solutions
  481. MaCh 8
  482. Maggie
  483. Magic Problem
  484. Magic squares
  485. Main Page/Suggestions
  486. Main page
  487. Making AI with Python
  488. Manchestermag.com
  489. Marin Mersenne
  490. Mark888's Hangout Corner
  491. Massass
  492. Math2016Center
  493. MathCON
  494. MathCounts: National Cutoffs
  495. MathLegend27
  496. Math Contest Camp 2008
  497. Math Contest Camp 2009
  498. Math Contest Camp 2010
  499. Math Contest Camp 2011
  500. Math Contest Camp 2012

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

Retrieved from "https://artofproblemsolving.com/wiki/index.php/Special:LonelyPages"