Orphaned pages
The following pages are not linked from or transcluded into other pages in AoPS Wiki.
Showing below up to 500 results in range #51 to #550.
View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)
- 2015 EGMO Problems
- 2015 Final tour - Azerbaijan in lower age category
- 2016 AMC 10 Problems
- 2016 EGMO Problems
- 2016 Mathcounts State Sprint Problems
- 2017 AMC 10B Problems/Problem 12/section=4
- 2017 EGMO Problems
- 2018 AMC 12 Problems/Problem 16
- 2018 EGMO Problems
- 2018 TSTST Problems
- 2019 AIME Problems
- 2019 AIME Problems/Problem 2
- 2019 AMC 10
- 2019 EGMO Problems
- 2019 ELMO Problems
- 2019 USAJMO Problems/Problem 10
- 2019 USAJMO Problems/Problem 69
- 2020 AMC 8 Problems/em 1
- 2020 EGMO Problems
- 2020 FMC 10A Problems
- 2020 FMC 12A Problems
- 2020 MATHCOUNTS Problems/Problem 8
- 2020 Mock Combo AMC 10
- 2020 USAMTS Round 1 Problems/Problem 3
- 2020 USAMTS Round 1 Problems/Problem 4
- 2020 USAMTS Round 1 Problems/Problem 5
- 2021 AMC 10B Problems/Problem 26
- 2021 AMC 10C
- 2021 AMC 10D
- 2021 AMC 1 Problems
- 2021 AMC 8 Problems
- 2021 AMC 8 Problems/Problem 1
- 2021 AMC 8 Problems/Problem 18
- 2021 AMC 8 Problems/Problem 2
- 2021 April MIMC 10
- 2021 April MIMC Problems/Problem 18
- 2021 April MIMC Problems/Problem 19
- 2021 EGMO Problems
- 2021 Euclid Problems
- 2021 Fall MIMC 10
- 2021 GMC 10B
- 2021 GMC 12
- 2021 GMC 12B
- 2021 HMC 10
- 2021 JMC 10
- 2021 JMPSC
- 2021 JMPSC Answer Key
- 2021 JMPSC Problems/Problem 1
- 2021 JMPSC Problems/Problem 2
- 2021 MECC Mock AMC 10
- 2021 MECC Mock AMC 12
- 2021 Mock AMC 8 Problems
- 2021 Mock AMC 8 Problems/Problem 1
- 2021 Mock AMC 8 Problems/Problem 2
- 2021 Mock AMC 8 Problems/Problem 3
- 2021 WSMO
- 2021 WSMO Speed Round/Problem 1
- 2021 ZeMC10
- 2022 DMC 10A Problems
- 2022 EGMO Problems
- 2022 Fall AMC 10B Problems
- 2022 MMATHS
- 2022 MMATHS Individual Round
- 2022 MMATHS Individual Round Problems
- 2022 MMATHS Problems/Problem 1
- 2023 AMC 10A Problems/Problem 26
- 2023 AMC 10A Problems/Problem 27
- 2023 AMC 10B Problems/Problem 26
- 2024 AMC 10B
- 2024 AMC 8 Problems/Problem 26
- 2024 AMC 8 Problems/Problem 27
- 2024 UAJMO Problems
- 2025 AMC 10A
- 2026 AMC 8 Problems
- 2027 AMC 8 Problems/Problem 1
- 2028 AMC 8
- 2030 AIME I
- 2050 AIME I
- 2100 AMC 8 Problems
- 403
- 404
- 7
- A
- A-Star Winter Math Camp
- A.chepuri
- AAMC
- AMC 10P
- AMC 12C 2019
- AMC 12C 2019/Problem 1
- AMC 12C 2020
- AMC 4
- AMC 8 Scheiße Scheisse and Solutions
- AMC 8 practice test
- AOPS
- API::Order::generate
- API:Product:get weight
- API Main Page
- AP Calculus
- A choose b
- A game board is constructed by shading two of the regions formed by the altitudes of an equilateral triangle as shown. What is the probability that the tip of the spinner will come to rest in a shaded region? Express your answer as a common fraction.
- A stock loses $10\%$ of its value on Monday. On Tuesday it loses $20\%$ of the value it had at the end of the day on Monday. What is the overall percent loss in value from the beginning of Monday to the end of Tuesday? Enter the answer as a percent.
- About weihang
- Aceplays
- Action
- Adazhao1227
- Add
- Additional signaling system at work
- Adriancheung
- Advanced Gmaasology
- Advanced Placement
- Ajax
- Alcumus
- Alex
- Algebra 2023
- Ali-A
- Alicebarnes33
- Alkjl
- All about Magic
- Alt front page
- Alternating permutation
- American Math Challenge
- Angle Addition Formulas (Trigonometry)
- Annual Inequations Contest
- Anthony Yang
- AoPSML Main Page
- AoPSWiki:Article of the Day/Archive
- AoPSWiki:Community Portal
- AoPS Math Club
- AoPS Online School/Algebra 2
- AoPS Online Schoolhouse
- Aops Guide to Math!
- Aops language
- Aopsav
- Aopslandia
- Apple
- Applicant Tracking Systems
- Arclength
- Areteem Camp
- Areteem Institute Summer Math Programs
- Arienhost.com
- Arrangement Restriction Theorem
- Arthur Benjamin
- Arthur Holly Compton Fellowships in the Physical Sciences and Mathematics
- Asymptote: Crash Course
- Asymptote: Example 1
- Asymptote: Macintosh
- Autograph
- Avid Academy for Gifted Youth
- Avogadro's Constant
- Awesomeguy856
- Awesomeming327
- Ayy-opsss
- B
- B2025tyx
- Badges
- Bard Math Circle Creative and Analytical Math Program (C.A.M.P.)
- Barrington High School
- Base arithmetic
- Base introduction
- Bash
- Bay Area Math Olympiad
- Beckyspencer3
- Benhlyrangcom
- Besot Power Series
- BestieTheorem
- Bestzack66's AMC10 Study Plan
- Bibhorr Formula
- Bill's Triangle
- Binomial Nomenclature
- Biswadev
- Bjc
- Blank Page
- BlockFi
- Bob Smart
- BoddapatiS
- Boredom Buster
- Brachistochrone
- Brazilformula
- Brocard's problem
- Brute for
- Bézout's Lemma
- CMO
- CSS: Downloads
- CSS: Positioning
- CSS: Properties
- CSS and HTML fundamentals
- Calculators
- Caltech
- Caltech Math Meet
- Camp-euclid
- Casey's Theoram
- Catch 22
- Catenary
- Cauchy's Criterion
- Cauchy-davenport
- Cavalieri's principle
- Cayley's Theorem
- Cell Theory
- Central NC MathCounts
- Centslordm
- Chakravala method
- Challenge Math Online Program
- Changelog
- Channing421
- Charfoal
- Chen's Theorem
- Chittur Gopalakrishnavishwanathasrinivasaiyer Lemma
- Circle Theorems
- Class Badges
- Classroom hacks
- Cloud neek
- Coalition Under Lovers of Trees
- Cohn's criterion
- Collections
- Complete residue system
- Computer simulation
- Concave Function
- Conservation of Momentum
- Constraints Strategy
- Contest Statistics
- Cool972 AMC 8 I
- Cozzmo
- Creating edited defaults
- Critical point
- Crouton
- Crusade
- Cumsniffer
- Curisen
- Curvature
- Cyclic function
- DVI exam
- Decagon
- Decembersnow13
- Decibel
- Descent
- Did you know that 3-2=1?
- Digon
- Dihedral angle
- Direacted lenght
- Direct Image Link
- Discordbetterthanaops
- Discrete quantity
- Dissection
- Distinct lines
- Doctorwho11
- Doggo
- Dolphinday
- Donguri
- Douglasubella
- Dunan's Theorem
- Dunan League
- Duwipr
- Earth
- Earth Science
- Easter Eggs
- Editing 2010 AMC 8 PROBLEMS/PROBLEM 24
- Ehawk11
- Emojis
- Erich Owen
- ErickMeyer4
- Euclid Problems and Solutions
- Euclid history Problems
- Euler's Four-Square Identity
- Euler's formula and It's history
- Euler's theorem
- European Girls' Mathematical Olympiad
- Exponentiation by squaring
- Exradius
- F=ma Exam
- FBIA
- FMO Problems and Solutions
- Fat Man on a Seesaw
- Fermat's Two Squares Theorem
- Fermat numbers
- Feuerbach point
- Finite Fourier Analysis
- Firecobra100
- First hundred primes
- Fixer
- Flec
- Fluorescence
- Foot Prints Of God
- Footballjornalista/
- For what real values of $c$ is $4x^2 + 5x^2 + 14x + x + c$ the square of a binomial?
- Forms of Figurative Language
- Formulas relating the number of lines, sections, and intersection points
- Forum Etiquette
- Forums
- Four
- Four fair coins are to be flipped. What is the probability that all four will be heads or all four will be tails? Express your answer as a common fraction.
- François Viète
- Invalid title with namespace "(Main)" and text "François_Viète"
- Free magma
- Frobenius automorphism
- Fucongcong
- Full of Baloney
- Fun Math Puzzles Unofficial
- GIFs
- GMAAS
- Gaamster
- Game Programming Contest
- Garmin launches a new FDA-cleared ECG app for the Venu 2 Plus
- Gauss's Lemma
- Gauss (Gr. 7 & 8)
- Gauss Grade 7 Year 2011 Problem 1
- Gauss Grade 7 Year 2011 Problem 2
- Gauss Grade 7 Year 2011 Problem 4
- Geometry Solutions
- Georgeooga-Harryooga Theroem
- Gergonne's Theorem
- Getting Started With JavaScript Programming
- Gg boiiis
- Ghsfaodsjfsdf theorum
- GloriaVaughn2
- Gmaasalaxy
- Gmaasiverse
- Gods Fighting Sim
- Graphgrid.asy
- Grog
- Halp!
- Happyshark's User Page
- Harry Kim
- Harvey
- Heavytoothpaste
- Helios Hong
- Hendecagon
- Heptadecagon
- Hexadecagon
- High-Quality Games and Fun
- Honest day's work
- Hook Length Theorem
- Horsepower
- Hotmonkey's current phrase
- How many four-digit, positive integers are there where each digit is a prime number?
- How many prime numbers are between 30 and 40?
- How many times does the digit 9 appear in the list of all integers from 1 to 500? (The number $ 99 $, for example, is counted twice, because $9$ appears two times in it.)
- How many ways can $1995$ be factored as a product of two two-digit numbers? (Two factorizations of the form $a\cdot b$ and $b\cdot a$ are considered the same).
- How should I prepare?
- How to Add and Subtract One-Digit Numbers
- How to Learn Turkish Language Fast
- How to display images or GIFs
- How to set up your new computer the right way
- HowtoHangStringLights
- Https://artofproblemsolving.com/wiki/index.php?title=File:AMC logo.png
- Huili2010
- Hyperbolic trig functions
- Hyundai Ioniq 5
- IDEAMATH
- Iabzcq
- Ice neek
- Icosagon
- Icosidigon
- Icosihenagon
- Idempotence
- Idkhtan Theorem
- If I have four boxes arranged in a $2 \times 2$ grid, in how many distinct ways can I place the digits $1$, $2$, and $3$ in the boxes, using each digit exactly once, such that each box contains at most one digit? (I only have one of each digit, so one box
- If no one shares an office, in how many ways can 3 people be assigned to 5 different offices? (Each person gets exactly one office).
- In the diagram, the equilateral triangle has a base of $8$ m. What is the perimeter of the triangle?
- In triangle ABC, D be a point in BC, ∠BAD = 30 , ∠CAD = 90 , BD=1=AC, DC =
- Index.php
- Indianvv
- Infinite Defenestration
- Inscribed Angle Proof(1)
- Insiders bet more on Fizz a social network that has now bubbled up at 80 college campuses
- Integrals
- IntelligentElephant2010
- Intermediate value property
- Internal combustion engines
- International Math Bowl
- Inverse trigonometric function
- Involution
- It1023
- JDKim
- JMPSC 2022 Division 1 Round 2 Problem 14
- JMPSC 2022 Problems
- Jadhav Quadratic Formula
- Jamesgray
- Jason321
- Jason Batterson
- Javascript
- Jayasharmaramankumarguptareddybavarajugopal's Lemma
- Jeff Boyd
- Joe wants to find all the four-letter words that begin and end with the same letter. How many combinations of letters satisfy this property?
- Jomity
- Joshua zucker
- Jugemu Jugemu Goko no Surikire Kaijarisuigyo no Suigyomatsu Unraimatsu Furaimatsu Ku Neru Tokoro ni Sumu Tokoro Yabura Koji no Bura Koji Paipo-paipo Paipo no ShuringanShuringan no Gurindai Gurindai no Ponpokopi no Ponpokona no Chokyumei no Chosuke.
- Juliankuang
- Jupiter314
- K1glaucus
- KGS math club
- Kenzopoker
- Kevin Zhao
- Kirchhoff's rules
- KiwiYum
- Kiwibird52
- Know the Facts: Gmaas
- Kuytltuyluyc
- Invalid title with namespace "(Main)" and text "L'Hôpital's_Rule"
- LaTeX/Installing
- Laa: Packages
- Lagrange Multipliers
- Latin square
- Laurent Series
- Lcz's Mock AMC 10A
- Lcz's Mock AMC 10A Problems
- Lcz's Oly Notes
- Lcz Notes!
- Learning Physics!
- Let $x$ be the number $9$ followed by $2015$ zeros. What is smallest integer greater than or equal to $x$ that is divisible by 11? Expression your answer in terms of $x$.
- Let a and b be nonzero real numbers such that (2 - 7i)(a + bi)is pure imaginary. Find a/b.
- Lifting the Exponent Lemma
- Lillian
- Liouville's Theorem
- List of national MathCounts teams
- Look at their Health Needs
- Lorde Shares Sweet Texts From Taylor Swift
- Lorentz Factor
- LostInBali
- LouisMedina23
- Lucasfunnyface
- Luckypotatopoo
- Luke zhang
- LuzPowell2
- MIE 2016/Day 1/Problem 10
- MIE 2016/Day 1/Problem 6
- MIE 2016/Day 1/Problem 7
- MIE 2016/Day 1/Problem 8
- MIE 2016/Problem 2
- MIE 2016/Problem 9
- MMFC
- MNCTOTO
- MSHSML Problems and Solutions
- MaCh 8
- Maggie
- Magic Problem
- Magic squares
- Main Page/Suggestions
- Main page
- Making AI with Python
- Manchestermag.com
- Marin Mersenne
- Mark888's Hangout Corner
- Massass
- Math2016Center
- MathCON
- MathCounts: National Cutoffs
- MathLegend27
- Math Contest Camp 2008
- Math Contest Camp 2009
- Math Contest Camp 2010
- Math Contest Camp 2011
- Math Contest Camp 2012
- Math Contest Camp 2013
- Math Contest Camp 2014
- Math Contest Camp 2015
- Math Contest Camp 2016
- Math Contest Camp 2017
- Math Contest Camp 2018
- Math M Addicts
- Math Masters of Minnesota
- Math and CS Research
- Mathboy282
- Mathematica Summer Camp
- Mathematica Summer Camp 2012
- Mathematical Red Rocket Competition
- Mathematical Red Rocket Competition Problems
- Mathematics careers
- Mathgirl199
- Mathjams
- Mathking999
- Mathtime Magazine
- Matrix Tree Theorem
- Median of a Triangle in LaTeX
- MehtA+ Machine Learning Bootcamp
- Mental Math
- Merge sort
- Metathesis Reaction
- Military Insitute of Engineering
- Mill's Constant
- Minor edit
- Mixed numbers
- Mock AIME 1 2005-2006
- Mock AIME 1 2005-2006/Problems
- Mock AIME 1 2013 Answer Key
- Mock AIME 1 2013 Problems/Problem 6
- Mock AIME 2 2005-2006
- Mock AIME 2 Pre 2005/Problems
- Mock AIME 3 2005-2006
- Mock AIME 3 2010
- Mock AIME 4 Pre 2005
- Mock AIME 6 Pre 2005/Problems
- Mock AIME I 2015
- Mock AIME I Problems
- Mock AMC 8
- Mock Amc 12
- Mock F=ma Contests
- Mock FAMAT
- Mock USAMO by probability1.01 dropped problems
- Modular inverse
- Modus ponens