Art of Problem Solving
AoPS Online
Math texts, online classes, and more
for students in grades 5-12.
Visit AoPS Online ‚
Books for Grades 5-12 Online Courses
Beast Academy
Engaging math books and online learning
for students ages 6-13.
Visit Beast Academy ‚
Books for Ages 6-13 Beast Academy Online
AoPS Academy
Small live classes for advanced math
and language arts learners in grades 2-12.
Visit AoPS Academy ‚
Find a Physical Campus Visit the Virtual Campus

Orphaned pages

The following pages are not linked from or transcluded into other pages in AoPS Wiki.

Showing below up to 500 results in range #51 to #550.

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

  1. 2015 EGMO Problems
  2. 2015 Final tour - Azerbaijan in lower age category
  3. 2016 AMC 10 Problems
  4. 2016 EGMO Problems
  5. 2016 Mathcounts State Sprint Problems
  6. 2017 AMC 10B Problems/Problem 12/section=4
  7. 2017 EGMO Problems
  8. 2018 AMC 12 Problems/Problem 16
  9. 2018 EGMO Problems
  10. 2018 TSTST Problems
  11. 2019 AIME Problems
  12. 2019 AIME Problems/Problem 2
  13. 2019 AMC 10
  14. 2019 EGMO Problems
  15. 2019 ELMO Problems
  16. 2019 USAJMO Problems/Problem 10
  17. 2019 USAJMO Problems/Problem 69
  18. 2020 AMC 8 Problems/em 1
  19. 2020 EGMO Problems
  20. 2020 FMC 10A Problems
  21. 2020 FMC 12A Problems
  22. 2020 MATHCOUNTS Problems/Problem 8
  23. 2020 Mock Combo AMC 10
  24. 2020 USAMTS Round 1 Problems/Problem 3
  25. 2020 USAMTS Round 1 Problems/Problem 4
  26. 2020 USAMTS Round 1 Problems/Problem 5
  27. 2021 AMC 10B Problems/Problem 26
  28. 2021 AMC 10C
  29. 2021 AMC 10D
  30. 2021 AMC 1 Problems
  31. 2021 AMC 8 Problems
  32. 2021 AMC 8 Problems/Problem 1
  33. 2021 AMC 8 Problems/Problem 18
  34. 2021 AMC 8 Problems/Problem 2
  35. 2021 April MIMC 10
  36. 2021 April MIMC Problems/Problem 18
  37. 2021 April MIMC Problems/Problem 19
  38. 2021 EGMO Problems
  39. 2021 Euclid Problems
  40. 2021 Fall MIMC 10
  41. 2021 GMC 10B
  42. 2021 GMC 12
  43. 2021 GMC 12B
  44. 2021 HMC 10
  45. 2021 JMC 10
  46. 2021 JMPSC
  47. 2021 JMPSC Answer Key
  48. 2021 JMPSC Problems/Problem 1
  49. 2021 JMPSC Problems/Problem 2
  50. 2021 MECC Mock AMC 10
  51. 2021 MECC Mock AMC 12
  52. 2021 Mock AMC 8 Problems
  53. 2021 Mock AMC 8 Problems/Problem 1
  54. 2021 Mock AMC 8 Problems/Problem 2
  55. 2021 Mock AMC 8 Problems/Problem 3
  56. 2021 WSMO
  57. 2021 WSMO Speed Round/Problem 1
  58. 2021 ZeMC10
  59. 2022 DMC 10A Problems
  60. 2022 EGMO Problems
  61. 2022 Fall AMC 10B Problems
  62. 2022 MMATHS
  63. 2022 MMATHS Individual Round
  64. 2022 MMATHS Individual Round Problems
  65. 2022 MMATHS Problems/Problem 1
  66. 2023 AMC 10A Problems/Problem 26
  67. 2023 AMC 10A Problems/Problem 27
  68. 2023 AMC 10B Problems/Problem 26
  69. 2024 AMC 10B
  70. 2024 AMC 8 Problems/Problem 26
  71. 2024 AMC 8 Problems/Problem 27
  72. 2024 UAJMO Problems
  73. 2025 AMC 10A
  74. 2026 AMC 8 Problems
  75. 2027 AMC 8 Problems/Problem 1
  76. 2028 AMC 8
  77. 2030 AIME I
  78. 2050 AIME I
  79. 2100 AMC 8 Problems
  80. 403
  81. 404
  82. 7
  83. A
  84. A-Star Winter Math Camp
  85. A.chepuri
  86. AAMC
  87. AMC 10P
  88. AMC 12C 2019
  89. AMC 12C 2019/Problem 1
  90. AMC 12C 2020
  91. AMC 4
  92. AMC 8 Scheiße Scheisse and Solutions
  93. AMC 8 practice test
  94. AOPS
  95. API::Order::generate
  96. API:Product:get weight
  97. API Main Page
  98. AP Calculus
  99. A choose b
  100. A game board is constructed by shading two of the regions formed by the altitudes of an equilateral triangle as shown. What is the probability that the tip of the spinner will come to rest in a shaded region? Express your answer as a common fraction.
  101. A stock loses $10\%$ of its value on Monday. On Tuesday it loses $20\%$ of the value it had at the end of the day on Monday. What is the overall percent loss in value from the beginning of Monday to the end of Tuesday? Enter the answer as a percent.
  102. About weihang
  103. Aceplays
  104. Action
  105. Adazhao1227
  106. Add
  107. Additional signaling system at work
  108. Adriancheung
  109. Advanced Gmaasology
  110. Advanced Placement
  111. Ajax
  112. Alcumus
  113. Alex
  114. Algebra 2023
  115. Ali-A
  116. Alicebarnes33
  117. Alkjl
  118. All about Magic
  119. Alt front page
  120. Alternating permutation
  121. American Math Challenge
  122. Angle Addition Formulas (Trigonometry)
  123. Annual Inequations Contest
  124. Anthony Yang
  125. AoPSML Main Page
  126. AoPSWiki:Article of the Day/Archive
  127. AoPSWiki:Community Portal
  128. AoPS Math Club
  129. AoPS Online School/Algebra 2
  130. AoPS Online Schoolhouse
  131. Aops Guide to Math!
  132. Aops language
  133. Aopsav
  134. Aopslandia
  135. Apple
  136. Applicant Tracking Systems
  137. Arclength
  138. Areteem Camp
  139. Areteem Institute Summer Math Programs
  140. Arienhost.com
  141. Arrangement Restriction Theorem
  142. Arthur Benjamin
  143. Arthur Holly Compton Fellowships in the Physical Sciences and Mathematics
  144. Asymptote: Crash Course
  145. Asymptote: Example 1
  146. Asymptote: Macintosh
  147. Autograph
  148. Avid Academy for Gifted Youth
  149. Avogadro's Constant
  150. Awesomeguy856
  151. Awesomeming327
  152. Ayy-opsss
  153. B
  154. B2025tyx
  155. Badges
  156. Bard Math Circle Creative and Analytical Math Program (C.A.M.P.)
  157. Barrington High School
  158. Base arithmetic
  159. Base introduction
  160. Bash
  161. Bay Area Math Olympiad
  162. Beckyspencer3
  163. Benhlyrangcom
  164. Besot Power Series
  165. BestieTheorem
  166. Bestzack66's AMC10 Study Plan
  167. Bibhorr Formula
  168. Bill's Triangle
  169. Binomial Nomenclature
  170. Biswadev
  171. Bjc
  172. Blank Page
  173. BlockFi
  174. Bob Smart
  175. BoddapatiS
  176. Boredom Buster
  177. Brachistochrone
  178. Brazilformula
  179. Brocard's problem
  180. Brute for
  181. Bézout's Lemma
  182. CMO
  183. CSS: Downloads
  184. CSS: Positioning
  185. CSS: Properties
  186. CSS and HTML fundamentals
  187. Calculators
  188. Caltech
  189. Caltech Math Meet
  190. Camp-euclid
  191. Casey's Theoram
  192. Catch 22
  193. Catenary
  194. Cauchy's Criterion
  195. Cauchy-davenport
  196. Cavalieri's principle
  197. Cayley's Theorem
  198. Cell Theory
  199. Central NC MathCounts
  200. Centslordm
  201. Chakravala method
  202. Challenge Math Online Program
  203. Changelog
  204. Channing421
  205. Charfoal
  206. Chen's Theorem
  207. Chittur Gopalakrishnavishwanathasrinivasaiyer Lemma
  208. Circle Theorems
  209. Class Badges
  210. Classroom hacks
  211. Cloud neek
  212. Coalition Under Lovers of Trees
  213. Cohn's criterion
  214. Collections
  215. Complete residue system
  216. Computer simulation
  217. Concave Function
  218. Conservation of Momentum
  219. Constraints Strategy
  220. Contest Statistics
  221. Cool972 AMC 8 I
  222. Cozzmo
  223. Creating edited defaults
  224. Critical point
  225. Crouton
  226. Crusade
  227. Cumsniffer
  228. Curisen
  229. Curvature
  230. Cyclic function
  231. DVI exam
  232. Decagon
  233. Decembersnow13
  234. Decibel
  235. Descent
  236. Did you know that 3-2=1?
  237. Digon
  238. Dihedral angle
  239. Direacted lenght
  240. Direct Image Link
  241. Discordbetterthanaops
  242. Discrete quantity
  243. Dissection
  244. Distinct lines
  245. Doctorwho11
  246. Doggo
  247. Dolphinday
  248. Donguri
  249. Douglasubella
  250. Dunan's Theorem
  251. Dunan League
  252. Duwipr
  253. Earth
  254. Earth Science
  255. Easter Eggs
  256. Editing 2010 AMC 8 PROBLEMS/PROBLEM 24
  257. Ehawk11
  258. Emojis
  259. Erich Owen
  260. ErickMeyer4
  261. Euclid Problems and Solutions
  262. Euclid history Problems
  263. Euler's Four-Square Identity
  264. Euler's formula and It's history
  265. Euler's theorem
  266. European Girls' Mathematical Olympiad
  267. Exponentiation by squaring
  268. Exradius
  269. F=ma Exam
  270. FBIA
  271. FMO Problems and Solutions
  272. Fat Man on a Seesaw
  273. Fermat's Two Squares Theorem
  274. Fermat numbers
  275. Feuerbach point
  276. Finite Fourier Analysis
  277. Firecobra100
  278. First hundred primes
  279. Fixer
  280. Flec
  281. Fluorescence
  282. Foot Prints Of God
  283. Footballjornalista/
  284. For what real values of $c$ is $4x^2 + 5x^2 + 14x + x + c$ the square of a binomial?
  285. Forms of Figurative Language
  286. Formulas relating the number of lines, sections, and intersection points
  287. Forum Etiquette
  288. Forums
  289. Four
  290. Four fair coins are to be flipped. What is the probability that all four will be heads or all four will be tails? Express your answer as a common fraction.
  291. François Viète
  292. Invalid title with namespace "(Main)" and text "François_Viète"
  293. Free magma
  294. Frobenius automorphism
  295. Fucongcong
  296. Full of Baloney
  297. Fun Math Puzzles Unofficial
  298. GIFs
  299. GMAAS
  300. Gaamster
  301. Game Programming Contest
  302. Garmin launches a new FDA-cleared ECG app for the Venu 2 Plus
  303. Gauss's Lemma
  304. Gauss (Gr. 7 & 8)
  305. Gauss Grade 7 Year 2011 Problem 1
  306. Gauss Grade 7 Year 2011 Problem 2
  307. Gauss Grade 7 Year 2011 Problem 4
  308. Geometry Solutions
  309. Georgeooga-Harryooga Theroem
  310. Gergonne's Theorem
  311. Getting Started With JavaScript Programming
  312. Gg boiiis
  313. Ghsfaodsjfsdf theorum
  314. GloriaVaughn2
  315. Gmaasalaxy
  316. Gmaasiverse
  317. Gods Fighting Sim
  318. Graphgrid.asy
  319. Grog
  320. Halp!
  321. Happyshark's User Page
  322. Harry Kim
  323. Harvey
  324. Heavytoothpaste
  325. Helios Hong
  326. Hendecagon
  327. Heptadecagon
  328. Hexadecagon
  329. High-Quality Games and Fun
  330. Honest day's work
  331. Hook Length Theorem
  332. Horsepower
  333. Hotmonkey's current phrase
  334. How many four-digit, positive integers are there where each digit is a prime number?
  335. How many prime numbers are between 30 and 40?
  336. How many times does the digit 9 appear in the list of all integers from 1 to 500? (The number $ 99 $, for example, is counted twice, because $9$ appears two times in it.)
  337. How many ways can $1995$ be factored as a product of two two-digit numbers? (Two factorizations of the form $a\cdot b$ and $b\cdot a$ are considered the same).
  338. How should I prepare?
  339. How to Add and Subtract One-Digit Numbers
  340. How to Learn Turkish Language Fast
  341. How to display images or GIFs
  342. How to set up your new computer the right way
  343. HowtoHangStringLights
  344. Https://artofproblemsolving.com/wiki/index.php?title=File:AMC logo.png
  345. Huili2010
  346. Hyperbolic trig functions
  347. Hyundai Ioniq 5
  348. IDEAMATH
  349. Iabzcq
  350. Ice neek
  351. Icosagon
  352. Icosidigon
  353. Icosihenagon
  354. Idempotence
  355. Idkhtan Theorem
  356. If I have four boxes arranged in a $2 \times 2$ grid, in how many distinct ways can I place the digits $1$, $2$, and $3$ in the boxes, using each digit exactly once, such that each box contains at most one digit? (I only have one of each digit, so one box
  357. If no one shares an office, in how many ways can 3 people be assigned to 5 different offices? (Each person gets exactly one office).
  358. In the diagram, the equilateral triangle has a base of $8$ m. What is the perimeter of the triangle?
  359. In triangle ABC, D be a point in BC, ∠BAD = 30 , ∠CAD = 90 , BD=1=AC, DC =
  360. Index.php
  361. Indianvv
  362. Infinite Defenestration
  363. Inscribed Angle Proof(1)
  364. Insiders bet more on Fizz a social network that has now bubbled up at 80 college campuses
  365. Integrals
  366. IntelligentElephant2010
  367. Intermediate value property
  368. Internal combustion engines
  369. International Math Bowl
  370. Inverse trigonometric function
  371. Involution
  372. It1023
  373. JDKim
  374. JMPSC 2022 Division 1 Round 2 Problem 14
  375. JMPSC 2022 Problems
  376. Jadhav Quadratic Formula
  377. Jamesgray
  378. Jason321
  379. Jason Batterson
  380. Javascript
  381. Jayasharmaramankumarguptareddybavarajugopal's Lemma
  382. Jeff Boyd
  383. Joe wants to find all the four-letter words that begin and end with the same letter. How many combinations of letters satisfy this property?
  384. Jomity
  385. Joshua zucker
  386. Jugemu Jugemu Goko no Surikire Kaijarisuigyo no Suigyomatsu Unraimatsu Furaimatsu Ku Neru Tokoro ni Sumu Tokoro Yabura Koji no Bura Koji Paipo-paipo Paipo no ShuringanShuringan no Gurindai Gurindai no Ponpokopi no Ponpokona no Chokyumei no Chosuke.
  387. Juliankuang
  388. Jupiter314
  389. K1glaucus
  390. KGS math club
  391. Kenzopoker
  392. Kevin Zhao
  393. Kirchhoff's rules
  394. KiwiYum
  395. Kiwibird52
  396. Know the Facts: Gmaas
  397. Kuytltuyluyc
  398. Invalid title with namespace "(Main)" and text "L'Hôpital's_Rule"
  399. LaTeX/Installing
  400. Laa: Packages
  401. Lagrange Multipliers
  402. Latin square
  403. Laurent Series
  404. Lcz's Mock AMC 10A
  405. Lcz's Mock AMC 10A Problems
  406. Lcz's Oly Notes
  407. Lcz Notes!
  408. Learning Physics!
  409. Let $x$ be the number $9$ followed by $2015$ zeros. What is smallest integer greater than or equal to $x$ that is divisible by 11? Expression your answer in terms of $x$.
  410. Let a and b be nonzero real numbers such that (2 - 7i)(a + bi)is pure imaginary. Find a/b.
  411. Lifting the Exponent Lemma
  412. Lillian
  413. Liouville's Theorem
  414. List of national MathCounts teams
  415. Look at their Health Needs
  416. Lorde Shares Sweet Texts From Taylor Swift
  417. Lorentz Factor
  418. LostInBali
  419. LouisMedina23
  420. Lucasfunnyface
  421. Luckypotatopoo
  422. Luke zhang
  423. LuzPowell2
  424. MIE 2016/Day 1/Problem 10
  425. MIE 2016/Day 1/Problem 6
  426. MIE 2016/Day 1/Problem 7
  427. MIE 2016/Day 1/Problem 8
  428. MIE 2016/Problem 2
  429. MIE 2016/Problem 9
  430. MMFC
  431. MNCTOTO
  432. MSHSML Problems and Solutions
  433. MaCh 8
  434. Maggie
  435. Magic Problem
  436. Magic squares
  437. Main Page/Suggestions
  438. Main page
  439. Making AI with Python
  440. Manchestermag.com
  441. Marin Mersenne
  442. Mark888's Hangout Corner
  443. Massass
  444. Math2016Center
  445. MathCON
  446. MathCounts: National Cutoffs
  447. MathLegend27
  448. Math Contest Camp 2008
  449. Math Contest Camp 2009
  450. Math Contest Camp 2010
  451. Math Contest Camp 2011
  452. Math Contest Camp 2012
  453. Math Contest Camp 2013
  454. Math Contest Camp 2014
  455. Math Contest Camp 2015
  456. Math Contest Camp 2016
  457. Math Contest Camp 2017
  458. Math Contest Camp 2018
  459. Math M Addicts
  460. Math Masters of Minnesota
  461. Math and CS Research
  462. Mathboy282
  463. Mathematica Summer Camp
  464. Mathematica Summer Camp 2012
  465. Mathematical Red Rocket Competition
  466. Mathematical Red Rocket Competition Problems
  467. Mathematics careers
  468. Mathgirl199
  469. Mathjams
  470. Mathking999
  471. Mathtime Magazine
  472. Matrix Tree Theorem
  473. Median of a Triangle in LaTeX
  474. MehtA+ Machine Learning Bootcamp
  475. Mental Math
  476. Merge sort
  477. Metathesis Reaction
  478. Military Insitute of Engineering
  479. Mill's Constant
  480. Minor edit
  481. Mixed numbers
  482. Mock AIME 1 2005-2006
  483. Mock AIME 1 2005-2006/Problems
  484. Mock AIME 1 2013 Answer Key
  485. Mock AIME 1 2013 Problems/Problem 6
  486. Mock AIME 2 2005-2006
  487. Mock AIME 2 Pre 2005/Problems
  488. Mock AIME 3 2005-2006
  489. Mock AIME 3 2010
  490. Mock AIME 4 Pre 2005
  491. Mock AIME 6 Pre 2005/Problems
  492. Mock AIME I 2015
  493. Mock AIME I Problems
  494. Mock AMC 8
  495. Mock Amc 12
  496. Mock F=ma Contests
  497. Mock FAMAT
  498. Mock USAMO by probability1.01 dropped problems
  499. Modular inverse
  500. Modus ponens

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

Retrieved from "https://artofproblemsolving.com/wiki/index.php/Special:LonelyPages"