Art of Problem Solving
AoPS Online
Math texts, online classes, and more
for students in grades 5-12.
Visit AoPS Online ‚
Books for Grades 5-12 Online Courses
Beast Academy
Engaging math books and online learning
for students ages 6-13.
Visit Beast Academy ‚
Books for Ages 6-13 Beast Academy Online
AoPS Academy
Small live classes for advanced math
and language arts learners in grades 2-12.
Visit AoPS Academy ‚
Find a Physical Campus Visit the Virtual Campus

Orphaned pages

The following pages are not linked from or transcluded into other pages in AoPS Wiki.

Showing below up to 250 results in range #51 to #300.

View (previous 250 | next 250) (20 | 50 | 100 | 250 | 500)

  1. 2015 EGMO Problems
  2. 2015 Final tour - Azerbaijan in lower age category
  3. 2016 AMC 10 Problems
  4. 2016 EGMO Problems
  5. 2016 Mathcounts State Sprint Problems
  6. 2017 AMC 10B Problems/Problem 12/section=4
  7. 2017 EGMO Problems
  8. 2018 AMC 12 Problems/Problem 16
  9. 2018 EGMO Problems
  10. 2018 TSTST Problems
  11. 2019 AIME Problems
  12. 2019 AIME Problems/Problem 2
  13. 2019 AMC 10
  14. 2019 EGMO Problems
  15. 2019 ELMO Problems
  16. 2019 USAJMO Problems/Problem 10
  17. 2019 USAJMO Problems/Problem 69
  18. 2020 AMC 8 Problems/em 1
  19. 2020 EGMO Problems
  20. 2020 FMC 10A Problems
  21. 2020 FMC 12A Problems
  22. 2020 MATHCOUNTS Problems/Problem 8
  23. 2020 Mock Combo AMC 10
  24. 2020 USAMTS Round 1 Problems/Problem 3
  25. 2020 USAMTS Round 1 Problems/Problem 4
  26. 2020 USAMTS Round 1 Problems/Problem 5
  27. 2021 AMC 10B Problems/Problem 26
  28. 2021 AMC 10C
  29. 2021 AMC 10D
  30. 2021 AMC 1 Problems
  31. 2021 AMC 8 Problems
  32. 2021 AMC 8 Problems/Problem 1
  33. 2021 AMC 8 Problems/Problem 18
  34. 2021 AMC 8 Problems/Problem 2
  35. 2021 April MIMC 10
  36. 2021 April MIMC Problems/Problem 18
  37. 2021 April MIMC Problems/Problem 19
  38. 2021 EGMO Problems
  39. 2021 Euclid Problems
  40. 2021 Fall MIMC 10
  41. 2021 GMC 10B
  42. 2021 GMC 12
  43. 2021 GMC 12B
  44. 2021 HMC 10
  45. 2021 JMC 10
  46. 2021 JMPSC
  47. 2021 JMPSC Answer Key
  48. 2021 JMPSC Problems/Problem 1
  49. 2021 JMPSC Problems/Problem 2
  50. 2021 MECC Mock AMC 10
  51. 2021 MECC Mock AMC 12
  52. 2021 Mock AMC 8 Problems
  53. 2021 Mock AMC 8 Problems/Problem 1
  54. 2021 Mock AMC 8 Problems/Problem 2
  55. 2021 Mock AMC 8 Problems/Problem 3
  56. 2021 WSMO
  57. 2021 WSMO Speed Round/Problem 1
  58. 2021 ZeMC10
  59. 2022 DMC 10A Problems
  60. 2022 EGMO Problems
  61. 2022 Fall AMC 10B Problems
  62. 2022 MMATHS
  63. 2022 MMATHS Individual Round
  64. 2022 MMATHS Individual Round Problems
  65. 2022 MMATHS Problems/Problem 1
  66. 2023 AMC 10A Problems/Problem 26
  67. 2023 AMC 10A Problems/Problem 27
  68. 2023 AMC 10B Problems/Problem 26
  69. 2024 AMC 10B
  70. 2024 AMC 8 Problems/Problem 26
  71. 2024 AMC 8 Problems/Problem 27
  72. 2024 UAJMO Problems
  73. 2025 AMC 10A
  74. 2026 AMC 8 Problems
  75. 2027 AMC 8 Problems/Problem 1
  76. 2028 AMC 8
  77. 2030 AIME I
  78. 2050 AIME I
  79. 2100 AMC 8 Problems
  80. 403
  81. 404
  82. 7
  83. A
  84. A-Star Winter Math Camp
  85. A.chepuri
  86. AAMC
  87. AMC 10P
  88. AMC 12C 2019
  89. AMC 12C 2019/Problem 1
  90. AMC 12C 2020
  91. AMC 4
  92. AMC 8 Scheiße Scheisse and Solutions
  93. AMC 8 practice test
  94. AOPS
  95. API::Order::generate
  96. API:Product:get weight
  97. API Main Page
  98. AP Calculus
  99. A choose b
  100. A game board is constructed by shading two of the regions formed by the altitudes of an equilateral triangle as shown. What is the probability that the tip of the spinner will come to rest in a shaded region? Express your answer as a common fraction.
  101. A stock loses $10\%$ of its value on Monday. On Tuesday it loses $20\%$ of the value it had at the end of the day on Monday. What is the overall percent loss in value from the beginning of Monday to the end of Tuesday? Enter the answer as a percent.
  102. About weihang
  103. Aceplays
  104. Action
  105. Adazhao1227
  106. Add
  107. Additional signaling system at work
  108. Adriancheung
  109. Advanced Gmaasology
  110. Advanced Placement
  111. Ajax
  112. Alcumus
  113. Alex
  114. Algebra 2023
  115. Ali-A
  116. Alicebarnes33
  117. Alkjl
  118. All about Magic
  119. Alt front page
  120. Alternating permutation
  121. American Math Challenge
  122. Angle Addition Formulas (Trigonometry)
  123. Annual Inequations Contest
  124. Anthony Yang
  125. AoPSML Main Page
  126. AoPSWiki:Article of the Day/Archive
  127. AoPSWiki:Community Portal
  128. AoPS Math Club
  129. AoPS Online School/Algebra 2
  130. AoPS Online Schoolhouse
  131. Aops Guide to Math!
  132. Aops language
  133. Aopsav
  134. Aopslandia
  135. Apple
  136. Applicant Tracking Systems
  137. Arclength
  138. Areteem Camp
  139. Areteem Institute Summer Math Programs
  140. Arienhost.com
  141. Arrangement Restriction Theorem
  142. Arthur Benjamin
  143. Arthur Holly Compton Fellowships in the Physical Sciences and Mathematics
  144. Asymptote: Crash Course
  145. Asymptote: Example 1
  146. Asymptote: Macintosh
  147. Autograph
  148. Avid Academy for Gifted Youth
  149. Avogadro's Constant
  150. Awesomeguy856
  151. Awesomeming327
  152. Ayy-opsss
  153. B
  154. B2025tyx
  155. Badges
  156. Bard Math Circle Creative and Analytical Math Program (C.A.M.P.)
  157. Barrington High School
  158. Base arithmetic
  159. Base introduction
  160. Bash
  161. Bay Area Math Olympiad
  162. Beckyspencer3
  163. Benhlyrangcom
  164. Besot Power Series
  165. BestieTheorem
  166. Bestzack66's AMC10 Study Plan
  167. Bibhorr Formula
  168. Bill's Triangle
  169. Binomial Nomenclature
  170. Biswadev
  171. Bjc
  172. Blank Page
  173. BlockFi
  174. Bob Smart
  175. BoddapatiS
  176. Boredom Buster
  177. Brachistochrone
  178. Brazilformula
  179. Brocard's problem
  180. Brute for
  181. Bézout's Lemma
  182. CMO
  183. CSS: Downloads
  184. CSS: Positioning
  185. CSS: Properties
  186. CSS and HTML fundamentals
  187. Calculators
  188. Caltech
  189. Caltech Math Meet
  190. Camp-euclid
  191. Casey's Theoram
  192. Catch 22
  193. Catenary
  194. Cauchy's Criterion
  195. Cauchy-davenport
  196. Cavalieri's principle
  197. Cayley's Theorem
  198. Cell Theory
  199. Central NC MathCounts
  200. Centslordm
  201. Chakravala method
  202. Challenge Math Online Program
  203. Changelog
  204. Channing421
  205. Charfoal
  206. Chen's Theorem
  207. Chittur Gopalakrishnavishwanathasrinivasaiyer Lemma
  208. Circle Theorems
  209. Class Badges
  210. Classroom hacks
  211. Cloud neek
  212. Coalition Under Lovers of Trees
  213. Cohn's criterion
  214. Collections
  215. Complete residue system
  216. Computer simulation
  217. Concave Function
  218. Conservation of Momentum
  219. Constraints Strategy
  220. Contest Statistics
  221. Cool972 AMC 8 I
  222. Cozzmo
  223. Creating edited defaults
  224. Critical point
  225. Crouton
  226. Crusade
  227. Cumsniffer
  228. Curisen
  229. Curvature
  230. Cyclic function
  231. DVI exam
  232. Decagon
  233. Decembersnow13
  234. Decibel
  235. Descent
  236. Did you know that 3-2=1?
  237. Digon
  238. Dihedral angle
  239. Direacted lenght
  240. Direct Image Link
  241. Discordbetterthanaops
  242. Discrete quantity
  243. Dissection
  244. Distinct lines
  245. Doctorwho11
  246. Doggo
  247. Dolphinday
  248. Donguri
  249. Douglasubella
  250. Dunan's Theorem

View (previous 250 | next 250) (20 | 50 | 100 | 250 | 500)

Retrieved from "https://artofproblemsolving.com/wiki/index.php/Special:LonelyPages"