Art of Problem Solving
AoPS Online
Math texts, online classes, and more
for students in grades 5-12.
Visit AoPS Online ‚
Books for Grades 5-12 Online Courses
Beast Academy
Engaging math books and online learning
for students ages 6-13.
Visit Beast Academy ‚
Books for Ages 6-13 Beast Academy Online
AoPS Academy
Small live classes for advanced math
and language arts learners in grades 2-12.
Visit AoPS Academy ‚
Find a Physical Campus Visit the Virtual Campus

Orphaned pages

The following pages are not linked from or transcluded into other pages in AoPS Wiki.

Showing below up to 500 results in range #51 to #550.

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

  1. 2015 EGMO Problems
  2. 2015 Final tour - Azerbaijan in lower age category
  3. 2016 AMC 10 Problems
  4. 2016 EGMO Problems
  5. 2016 Mathcounts State Sprint Problems
  6. 2017 AMC 10B Problems/Problem 12/section=4
  7. 2017 EGMO Problems
  8. 2018 AMC 12 Problems/Problem 16
  9. 2018 EGMO Problems
  10. 2018 TSTST Problems
  11. 2019 AIME Problems
  12. 2019 AIME Problems/Problem 2
  13. 2019 AMC 10
  14. 2019 EGMO Problems
  15. 2019 ELMO Problems
  16. 2019 USAJMO Problems/Problem 10
  17. 2019 USAJMO Problems/Problem 69
  18. 2020 AMC 8 Problems/em 1
  19. 2020 EGMO Problems
  20. 2020 FMC 10A Problems
  21. 2020 FMC 12A Problems
  22. 2020 MATHCOUNTS Problems/Problem 8
  23. 2020 Mock Combo AMC 10
  24. 2020 USAMTS Round 1 Problems/Problem 3
  25. 2020 USAMTS Round 1 Problems/Problem 4
  26. 2020 USAMTS Round 1 Problems/Problem 5
  27. 2021 AMC 10B Problems/Problem 26
  28. 2021 AMC 10C
  29. 2021 AMC 10D
  30. 2021 AMC 1 Problems
  31. 2021 AMC 8 Problems
  32. 2021 AMC 8 Problems/Problem 1
  33. 2021 AMC 8 Problems/Problem 18
  34. 2021 AMC 8 Problems/Problem 2
  35. 2021 April MIMC 10
  36. 2021 April MIMC Problems/Problem 18
  37. 2021 April MIMC Problems/Problem 19
  38. 2021 EGMO Problems
  39. 2021 Euclid Problems
  40. 2021 Fall MIMC 10
  41. 2021 GMC 10B
  42. 2021 GMC 12
  43. 2021 GMC 12B
  44. 2021 HMC 10
  45. 2021 JMC 10
  46. 2021 JMPSC
  47. 2021 JMPSC Answer Key
  48. 2021 JMPSC Problems/Problem 1
  49. 2021 JMPSC Problems/Problem 2
  50. 2021 MECC Mock AMC 10
  51. 2021 MECC Mock AMC 12
  52. 2021 Mock AMC 8 Problems
  53. 2021 Mock AMC 8 Problems/Problem 1
  54. 2021 Mock AMC 8 Problems/Problem 2
  55. 2021 Mock AMC 8 Problems/Problem 3
  56. 2021 WSMO
  57. 2021 WSMO Speed Round/Problem 1
  58. 2021 ZeMC10
  59. 2022 DMC 10A Problems
  60. 2022 EGMO Problems
  61. 2022 Fall AMC 10B Problems
  62. 2022 MMATHS
  63. 2022 MMATHS Individual Round
  64. 2022 MMATHS Individual Round Problems
  65. 2022 MMATHS Problems/Problem 1
  66. 2023 AMC 10A Problems/Problem 26
  67. 2023 AMC 10A Problems/Problem 27
  68. 2023 AMC 10B Problems/Problem 26
  69. 2024 AMC 10B
  70. 2024 AMC 8 Problems/Problem 26
  71. 2024 AMC 8 Problems/Problem 27
  72. 2024 UAJMO Problems
  73. 2025 AMC 10A
  74. 2026 AMC 8 Problems
  75. 2027 AMC 8 Problems/Problem 1
  76. 2028 AMC 8
  77. 2030 AIME I
  78. 2050 AIME I
  79. 2100 AMC 8 Problems
  80. 403
  81. 404
  82. 7
  83. A
  84. A-Star Winter Math Camp
  85. A.chepuri
  86. AAMC
  87. AMC 10P
  88. AMC 12C 2019
  89. AMC 12C 2019/Problem 1
  90. AMC 12C 2020
  91. AMC 4
  92. AMC 8 Scheiße Scheisse and Solutions
  93. AMC 8 practice test
  94. AOPS
  95. API::Order::generate
  96. API:Product:get weight
  97. API Main Page
  98. AP Calculus
  99. A choose b
  100. A game board is constructed by shading two of the regions formed by the altitudes of an equilateral triangle as shown. What is the probability that the tip of the spinner will come to rest in a shaded region? Express your answer as a common fraction.
  101. A stock loses $10\%$ of its value on Monday. On Tuesday it loses $20\%$ of the value it had at the end of the day on Monday. What is the overall percent loss in value from the beginning of Monday to the end of Tuesday? Enter the answer as a percent.
  102. About weihang
  103. Aceplays
  104. Action
  105. Adazhao1227
  106. Add
  107. Additional signaling system at work
  108. Adriancheung
  109. Advanced Gmaasology
  110. Advanced Placement
  111. Ajax
  112. Alcumus
  113. Alex
  114. Algebra 2023
  115. Ali-A
  116. Alicebarnes33
  117. Alkjl
  118. All about Magic
  119. Alt front page
  120. Alternating permutation
  121. American Math Challenge
  122. Angle Addition Formulas (Trigonometry)
  123. Annual Inequations Contest
  124. Anthony Yang
  125. AoPSML Main Page
  126. AoPSWiki:Article of the Day/Archive
  127. AoPSWiki:Community Portal
  128. AoPS Math Club
  129. AoPS Online School/Algebra 2
  130. AoPS Online Schoolhouse
  131. Aops Guide to Math!
  132. Aops language
  133. Aopsav
  134. Aopslandia
  135. Apple
  136. Applicant Tracking Systems
  137. Arclength
  138. Areteem Camp
  139. Areteem Institute Summer Math Programs
  140. Arienhost.com
  141. Arrangement Restriction Theorem
  142. Arthur Benjamin
  143. Arthur Holly Compton Fellowships in the Physical Sciences and Mathematics
  144. Asymptote: Crash Course
  145. Asymptote: Example 1
  146. Asymptote: Macintosh
  147. Autograph
  148. Avid Academy for Gifted Youth
  149. Avogadro's Constant
  150. Awesomeguy856
  151. Awesomeming327
  152. Ayy-opsss
  153. B
  154. B2025tyx
  155. Badges
  156. Bard Math Circle Creative and Analytical Math Program (C.A.M.P.)
  157. Barrington High School
  158. Base arithmetic
  159. Base introduction
  160. Bash
  161. Bay Area Math Olympiad
  162. Beckyspencer3
  163. Benhlyrangcom
  164. Besot Power Series
  165. BestieTheorem
  166. Bestzack66's AMC10 Study Plan
  167. Bibhorr Formula
  168. Bill's Triangle
  169. Binomial Nomenclature
  170. Biswadev
  171. Bjc
  172. Blank Page
  173. BlockFi
  174. Bob Smart
  175. BoddapatiS
  176. Boredom Buster
  177. Brachistochrone
  178. Brazilformula
  179. Brocard's problem
  180. Brute for
  181. Bézout's Lemma
  182. CMO
  183. CSS: Downloads
  184. CSS: Positioning
  185. CSS: Properties
  186. CSS and HTML fundamentals
  187. Calculators
  188. Caltech
  189. Caltech Math Meet
  190. Camp-euclid
  191. Casey's Theoram
  192. Catch 22
  193. Catenary
  194. Cauchy's Criterion
  195. Cauchy-davenport
  196. Cavalieri's principle
  197. Cayley's Theorem
  198. Cell Theory
  199. Central NC MathCounts
  200. Centslordm
  201. Chakravala method
  202. Changelog
  203. Channing421
  204. Charfoal
  205. Chen's Theorem
  206. Chittur Gopalakrishnavishwanathasrinivasaiyer Lemma
  207. Circle Theorems
  208. Class Badges
  209. Classroom hacks
  210. Cloud neek
  211. Coalition Under Lovers of Trees
  212. Cohn's criterion
  213. Collections
  214. Complete residue system
  215. Computer simulation
  216. Concave Function
  217. Conservation of Momentum
  218. Constraints Strategy
  219. Contest Statistics
  220. Cool972 AMC 8 I
  221. Cozzmo
  222. Creating edited defaults
  223. Critical point
  224. Crouton
  225. Crusade
  226. Cumsniffer
  227. Curisen
  228. Curvature
  229. Cyclic function
  230. DVI exam
  231. Decagon
  232. Decembersnow13
  233. Decibel
  234. Descent
  235. Did you know that 3-2=1?
  236. Digon
  237. Dihedral angle
  238. Direacted lenght
  239. Direct Image Link
  240. Discordbetterthanaops
  241. Discrete quantity
  242. Dissection
  243. Distinct lines
  244. Doctorwho11
  245. Doggo
  246. Dolphinday
  247. Donguri
  248. Douglasubella
  249. Dunan's Theorem
  250. Dunan League
  251. Duwipr
  252. Earth
  253. Earth Science
  254. Easter Eggs
  255. Editing 2010 AMC 8 PROBLEMS/PROBLEM 24
  256. Ehawk11
  257. Emojis
  258. Erich Owen
  259. ErickMeyer4
  260. Euclid Problems and Solutions
  261. Euclid history Problems
  262. Euler's Four-Square Identity
  263. Euler's formula and It's history
  264. Euler's theorem
  265. European Girls' Mathematical Olympiad
  266. Exponentiation by squaring
  267. Exradius
  268. F=ma Exam
  269. FBIA
  270. FMO Problems and Solutions
  271. Fat Man on a Seesaw
  272. Fermat's Two Squares Theorem
  273. Fermat numbers
  274. Feuerbach point
  275. Finite Fourier Analysis
  276. Firecobra100
  277. First hundred primes
  278. Fixer
  279. Flec
  280. Fluorescence
  281. Foot Prints Of God
  282. Footballjornalista/
  283. For what real values of $c$ is $4x^2 + 5x^2 + 14x + x + c$ the square of a binomial?
  284. Forms of Figurative Language
  285. Formulas relating the number of lines, sections, and intersection points
  286. Forum Etiquette
  287. Forums
  288. Four
  289. Four fair coins are to be flipped. What is the probability that all four will be heads or all four will be tails? Express your answer as a common fraction.
  290. François Viète
  291. Invalid title with namespace "(Main)" and text "François_Viète"
  292. Free magma
  293. Frobenius automorphism
  294. Fucongcong
  295. Full of Baloney
  296. Fun Math Puzzles Unofficial
  297. GIFs
  298. GMAAS
  299. Gaamster
  300. Game Programming Contest
  301. Garmin launches a new FDA-cleared ECG app for the Venu 2 Plus
  302. Gauss's Lemma
  303. Gauss (Gr. 7 & 8)
  304. Gauss Grade 7 Year 2011 Problem 1
  305. Gauss Grade 7 Year 2011 Problem 2
  306. Gauss Grade 7 Year 2011 Problem 4
  307. Geometry Solutions
  308. Georgeooga-Harryooga Theroem
  309. Gergonne's Theorem
  310. Getting Started With JavaScript Programming
  311. Gg boiiis
  312. Ghsfaodsjfsdf theorum
  313. GloriaVaughn2
  314. Gmaasalaxy
  315. Gmaasiverse
  316. Gods Fighting Sim
  317. Graphgrid.asy
  318. Grog
  319. Halp!
  320. Happyshark's User Page
  321. Harry Kim
  322. Harvey
  323. Heavytoothpaste
  324. Helios Hong
  325. Hendecagon
  326. Heptadecagon
  327. Hexadecagon
  328. High-Quality Games and Fun
  329. Honest day's work
  330. Hook Length Theorem
  331. Horsepower
  332. Hotmonkey's current phrase
  333. How many four-digit, positive integers are there where each digit is a prime number?
  334. How many prime numbers are between 30 and 40?
  335. How many times does the digit 9 appear in the list of all integers from 1 to 500? (The number $ 99 $, for example, is counted twice, because $9$ appears two times in it.)
  336. How many ways can $1995$ be factored as a product of two two-digit numbers? (Two factorizations of the form $a\cdot b$ and $b\cdot a$ are considered the same).
  337. How should I prepare?
  338. How to Add and Subtract One-Digit Numbers
  339. How to Learn Turkish Language Fast
  340. How to display images or GIFs
  341. How to set up your new computer the right way
  342. HowtoHangStringLights
  343. Https://artofproblemsolving.com/wiki/index.php?title=File:AMC logo.png
  344. Huili2010
  345. Hyperbolic trig functions
  346. Hyundai Ioniq 5
  347. IDEAMATH
  348. Iabzcq
  349. Ice neek
  350. Icosagon
  351. Icosidigon
  352. Icosihenagon
  353. Idempotence
  354. Idkhtan Theorem
  355. If I have four boxes arranged in a $2 \times 2$ grid, in how many distinct ways can I place the digits $1$, $2$, and $3$ in the boxes, using each digit exactly once, such that each box contains at most one digit? (I only have one of each digit, so one box
  356. If no one shares an office, in how many ways can 3 people be assigned to 5 different offices? (Each person gets exactly one office).
  357. In the diagram, the equilateral triangle has a base of $8$ m. What is the perimeter of the triangle?
  358. In triangle ABC, D be a point in BC, ∠BAD = 30 , ∠CAD = 90 , BD=1=AC, DC =
  359. Index.php
  360. Indianvv
  361. Infinite Defenestration
  362. Inscribed Angle Proof(1)
  363. Insiders bet more on Fizz a social network that has now bubbled up at 80 college campuses
  364. Integrals
  365. IntelligentElephant2010
  366. Intermediate value property
  367. Internal combustion engines
  368. International Math Bowl
  369. Inverse trigonometric function
  370. Involution
  371. It1023
  372. JDKim
  373. JMPSC 2022 Division 1 Round 2 Problem 14
  374. JMPSC 2022 Problems
  375. Jadhav Quadratic Formula
  376. Jamesgray
  377. Jason321
  378. Jason Batterson
  379. Javascript
  380. Jayasharmaramankumarguptareddybavarajugopal's Lemma
  381. Jeff Boyd
  382. Joe wants to find all the four-letter words that begin and end with the same letter. How many combinations of letters satisfy this property?
  383. Jomity
  384. Joshua zucker
  385. Jugemu Jugemu Goko no Surikire Kaijarisuigyo no Suigyomatsu Unraimatsu Furaimatsu Ku Neru Tokoro ni Sumu Tokoro Yabura Koji no Bura Koji Paipo-paipo Paipo no ShuringanShuringan no Gurindai Gurindai no Ponpokopi no Ponpokona no Chokyumei no Chosuke.
  386. Juliankuang
  387. Jupiter314
  388. K1glaucus
  389. KGS math club
  390. Kenzopoker
  391. Kevin Zhao
  392. Kirchhoff's rules
  393. KiwiYum
  394. Kiwibird52
  395. Know the Facts: Gmaas
  396. Kuytltuyluyc
  397. Invalid title with namespace "(Main)" and text "L'Hôpital's_Rule"
  398. LaTeX/Installing
  399. Laa: Packages
  400. Lagrange Multipliers
  401. Latin square
  402. Laurent Series
  403. Lcz's Mock AMC 10A
  404. Lcz's Mock AMC 10A Problems
  405. Lcz's Oly Notes
  406. Lcz Notes!
  407. Learning Physics!
  408. Let $x$ be the number $9$ followed by $2015$ zeros. What is smallest integer greater than or equal to $x$ that is divisible by 11? Expression your answer in terms of $x$.
  409. Let a and b be nonzero real numbers such that (2 - 7i)(a + bi)is pure imaginary. Find a/b.
  410. Lifting the Exponent Lemma
  411. Lillian
  412. Liouville's Theorem
  413. List of national MathCounts teams
  414. Look at their Health Needs
  415. Lorde Shares Sweet Texts From Taylor Swift
  416. Lorentz Factor
  417. LostInBali
  418. LouisMedina23
  419. Lucasfunnyface
  420. Luckypotatopoo
  421. Luke zhang
  422. LuzPowell2
  423. MIE 2016/Day 1/Problem 10
  424. MIE 2016/Day 1/Problem 6
  425. MIE 2016/Day 1/Problem 7
  426. MIE 2016/Day 1/Problem 8
  427. MIE 2016/Problem 2
  428. MIE 2016/Problem 9
  429. MMFC
  430. MNCTOTO
  431. MSHSML Problems and Solutions
  432. MaCh 8
  433. Maggie
  434. Magic Problem
  435. Magic squares
  436. Main Page/Suggestions
  437. Main page
  438. Making AI with Python
  439. Manchestermag.com
  440. Marin Mersenne
  441. Mark888's Hangout Corner
  442. Massass
  443. Math2016Center
  444. MathCON
  445. MathCounts: National Cutoffs
  446. MathLegend27
  447. Math Contest Camp 2008
  448. Math Contest Camp 2009
  449. Math Contest Camp 2010
  450. Math Contest Camp 2011
  451. Math Contest Camp 2012
  452. Math Contest Camp 2013
  453. Math Contest Camp 2014
  454. Math Contest Camp 2015
  455. Math Contest Camp 2016
  456. Math Contest Camp 2017
  457. Math Contest Camp 2018
  458. Math M Addicts
  459. Math Masters of Minnesota
  460. Math and CS Research
  461. Mathboy282
  462. Mathematica Summer Camp
  463. Mathematica Summer Camp 2012
  464. Mathematical Red Rocket Competition
  465. Mathematical Red Rocket Competition Problems
  466. Mathematics careers
  467. Mathgirl199
  468. Mathjams
  469. Mathking999
  470. Mathtime Magazine
  471. Matrix Tree Theorem
  472. Median of a Triangle in LaTeX
  473. MehtA+ Machine Learning Bootcamp
  474. Mental Math
  475. Merge sort
  476. Metathesis Reaction
  477. Military Insitute of Engineering
  478. Mill's Constant
  479. Minor edit
  480. Mixed numbers
  481. Mock AIME 1 2005-2006
  482. Mock AIME 1 2005-2006/Problems
  483. Mock AIME 1 2013 Answer Key
  484. Mock AIME 1 2013 Problems/Problem 6
  485. Mock AIME 2 2005-2006
  486. Mock AIME 2 Pre 2005/Problems
  487. Mock AIME 3 2005-2006
  488. Mock AIME 3 2010
  489. Mock AIME 4 Pre 2005
  490. Mock AIME 6 Pre 2005/Problems
  491. Mock AIME I 2015
  492. Mock AIME I Problems
  493. Mock AMC 8
  494. Mock Amc 12
  495. Mock F=ma Contests
  496. Mock FAMAT
  497. Mock USAMO by probability1.01 dropped problems
  498. Modular inverse
  499. Modus ponens
  500. Molar heat capacity

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

Retrieved from "https://artofproblemsolving.com/wiki/index.php/Special:LonelyPages"